PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0040s0520.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 488aa    MW: 53448 Da    PI: 5.5081
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0040s0520.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS171.66.1e-533234863167
                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lL++cA+av+ gd++ a++lL+++++++sp+gd++qRla+yf+ AL +rla++ +  +  + + +ts    ++ l+a+++++ ++P
  SapurV1A.0040s0520.3.p 323 SLLIQCAQAVAIGDQRTASELLQQIRQHSSPHGDANQRLAHYFADALDTRLAGTATPAFTLFVSPRTS---AADILKAYQVYVRACP 406
                             79***************************************************766666666555554...89************** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLak 167
                             + ++s++ aN++Il+  ++++r+HiiDf+i +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+rL++
  SapurV1A.0040s0520.3.p 407 FKRMSNFFANRTILKLEKKATRLHIIDFGILYGFQWPCLIQRLSERPGGPPKLRITGIELPQPGfrPAERVEETGRRLER 486
                             ***************************************************************9**************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.441295487IPR005202Transcription factor GRAS
PfamPF035142.1E-50323486IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MFDHASVSFS PNRNRFDGYK LNDTMSDPNP SFNSSNPEPP NDSASPTSSS SSSSESYGPS  60
NNVTLKFISD VLLEEDLEGK TCMLQDCLAL QAAEKSFYDV LGQEYPHSSN QIRSCFDQNF  120
ESPGNGFTWR SGVDSSKSYP PGNNLVEKSD WVFDQSDLDF YQAQASPVLP LERTLLGPDL  180
HSPVHPFEVL SKGGGDADSF LSGNDYLMAS SASNSSNPPD KDDGEHSPNS SRGRKNHQRE  240
DSDGLEEERS KKQSALSPAD SELSELLDEV LLCSVGQNES TSCSLLGNSQ NGAAGNEQRK  300
GSNGRTARGK KRGKKGEVVD SSSLLIQCAQ AVAIGDQRTA SELLQQIRQH SSPHGDANQR  360
LAHYFADALD TRLAGTATPA FTLFVSPRTS AADILKAYQV YVRACPFKRM SNFFANRTIL  420
KLEKKATRLH IIDFGILYGF QWPCLIQRLS ERPGGPPKLR ITGIELPQPG FRPAERVEET  480
GRRLERY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-253254878170GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042725.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE581e-84SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9HPF30.0B9HPF3_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.19e-73SCARECROW-like 14